PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06590g02002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 181aa    MW: 20823.2 Da    PI: 9.2638
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06590g02002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.9e-19564357
                              --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                              +R+++t+eql +L+e+++k   +p+a++ e+ +++l    ++++++V++WFqN++a+ekk
  Niben101Scf06590g02002.1  5 TRWSPTQEQLMILQEMYRKgLTNPNAAQLERVTDHLslfgKIETKNVFYWFQNHKAREKK 64
                              8*****************99***************************************8 PP

2Wus_type_Homeobox104.37.8e-34465364
         Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                              +tRW+Pt+eQ++iL+e+y++Gl +Pn+++++r+t +L+ +Gkie kNVfyWFQN+kaRe++k
  Niben101Scf06590g02002.1  4 HTRWSPTQEQLMILQEMYRKGLTNPNAAQLERVTDHLSLFGKIETKNVFYWFQNHKAREKKK 65
                              69**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.43165IPR001356Homeobox domain
SMARTSM003896.0E-7269IPR001356Homeobox domain
SuperFamilySSF466891.58E-10471IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-7565IPR009057Homeodomain-like
PfamPF000461.5E-16564IPR001356Homeobox domain
CDDcd000867.66E-5562No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MTGHTRWSPT QEQLMILQEM YRKGLTNPNA AQLERVTDHL SLFGKIETKN VFYWFQNHKA  60
REKKKLKKKF LMQMNQQQQM SINNDLNLPL FTSSTRLMAE VEDASTRLMN SLWNMNPPVP  120
NTCDMETCMM RAQGPHFILM MDIVPNPTSL PCISSNTPLK TLELFPVTAS SSLKDLAKEV  180
S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766251.11e-102PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLC9WKA64e-55C9WKA6_PETHY; WOX3 protein
STRINGSolyc11g072790.1.18e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.18e-27WOX family protein